PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00000558-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family NZZ/SPL
Protein Properties Length: 454aa    MW: 50124.4 Da    PI: 8.7815
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00000558-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE21.24.7e-076111453106
              NOZZLE  53 qqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssvaaisntatrlpvpv 106
                         + kqkk   rg+gva+le+ ++ee++kk v+a     +sv+    +   lp+p 
  WALNUT_00000558-RA  61 NPKQKKAPQRGLGVAQLEKIRLEEQQKKDVAAILSPPASVSQRESSFLSLPIPT 114
                         45899999***********************99999999998888888888875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MTDIRPTKHI NAPPPETDNL DWNVLTIIWK RTRMDKADQT QRYNNSGSGG GIGGVARSSK  60
NPKQKKAPQR GLGVAQLEKI RLEEQQKKDV AAILSPPASV SQRESSFLSL PIPTYHHSNP  120
SSCSIPFPSP SLPDLSSRDL LIRPPQPGQN NDEKNSSTVN SAGFEAGWLG ISVPGLGCVP  180
KLRNSHEYNL EKENSGMDPR LAFRSNLNLP YESDNHIWPP PSLMPKTQQY QQQPMVNVSS  240
GTSSSSVLNF RMEPPSNQSY YCNYSPMWPP EEVKMVGTKR LYPFSLDNSS GPSSHYKLPS  300
LVVPVRSDES ASCENVGMFN FEGSNSILRG RPSWSTSISN SNLNSNKSIK ENEVIKGEFL  360
SLSPRITSTC PSSKFMQHSA CLASQDPRFR DESLPYQGIV EDPIIKPAGS SLLNQQPPFY  420
YFLPPAKEQI GKATTTMNNC NGGVGERIDL NLKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211627.11e-100hypothetical protein PRUPE_ppa005691mg
TrEMBLM5WHS41e-100M5WHS4_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s38460.12e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89561213
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27330.11e-06sporocyteless (SPL)